PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G0783
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family HB-other
Protein Properties Length: 966aa    MW: 105878 Da    PI: 7.192
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G0783genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.34.7e-0761117157
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                  +r+R  ++++ ++ ++++F  +  ++++e +e++++ g+t +qV+ +F  +R++ +k
  Gh_D08G0783  61 KRPRDLLNPKAVKYMQAVFSIKDAITKKESREISAQFGVTVTQVRDFFNSQRTRVRK 117
                  799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.64158118IPR001356Homeobox domain
SuperFamilySSF466898.98E-760122IPR009057Homeodomain-like
SMARTSM003895.2E-560122IPR001356Homeobox domain
PfamPF000461.9E-461117IPR001356Homeobox domain
CDDcd000861.01E-561118No hitNo description
Gene3DG3DSA:1.10.10.603.2E-761128IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.103.7E-5218310IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476763.14E-5219309IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 966 aa     Download sequence    Send to blast
MDVLKENLAE LEIGSTVESI QKFIEIQREL FHSQIDQLQN VVVTQCKLTG VNPLAQEMVR  60
KRPRDLLNPK AVKYMQAVFS IKDAITKKES REISAQFGVT VTQVRDFFNS QRTRVRKQVR  120
LSREKALRSN ACKEAEDGVL PTGSEAVIPV EPVPLNSVGP VSSEEAPSCS TQDDSLTGID  180
ELDKHFVENI FSKMHKEETF SGQVKLMEWT LQILNPSVLY WFLNKGGVMI LATWLSQAAV  240
EEQTTVVLII LKVLSHLPLQ KALPEHMSAI LQSVNKLCLY RFSDISNRAR LLISRWSKMF  300
ARSQAAKKPN GLRSSTETQN EMLLKQSISE IMGHGSWQSN VYNSEGTLAT SNVRKESPQV  360
LKLLPASMDD SAKKNLLGVS SSHSRERRRV QLVEQPGQKV AGKNSQTTRP VPISQSRPMS  420
ADDIQKAKMR ALYMQSKHGK TGSSSNGMNE VKSEGLNKSS PSKASFSRPV SKVPSHPAEE  480
QKKPVVLPPK TSSRVETSLD PKQPVASKES PWEKCQKVKI PWHIPPEVKI NDLWSVGAGE  540
SSKEVHVQKN RNRRERETFY YTNQEIPSNP KEPWDREMDH DDSLTPEIPT EQPPDNETET  600
QVTHGEHVNG AATLEPSTSQ TGGAVSAEPD LELLAVLLKN PALVFALTSG QAGNLTSEET  660
VKLLDMIKAG GADTGNNVEE KVEVSLPSPT PSTNPGTSGW RPEAVRNPFS QHSQMGNRVA  720
QASVGVVTPI PVAERLSATG MAAPQQEANG LSLAQQLAAA MAELLPQSNA TTLDKRHSPN  780
VAFSNHGHPS NLPASDIALT MKNPSLVNSL TNSSAAAGPS MWVETMNVKT AAISMAPHIP  840
EKVQTSFSPS PLMPTLTQLQ PQVPHASDPY STRPPVGNLG PMPDPWRGRQ SLGSNLHSQA  900
NQNNYNASSF GGSMHPQLRT DPPREGKEYA GNEELIGHHG KEIHLGIETR TDREIDGVTE  960
DDDEAG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.144080.0ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012474033.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-170LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A0D2QUG60.0A0A0D2QUG6_G
STRINGPOPTR_0002s20990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-165HB-other family protein